DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox12

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001025449.1 Gene:sox12 / 562381 ZFINID:ZDB-GENE-040724-33 Length:355 Species:Danio rerio


Alignment Length:252 Identity:92/252 - (36%)
Similarity:124/252 - (49%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMK 204
            ||||||||||||||:::||:|.:..|.|||:|||||||..||||.:.||.|||.||:|||..||.
Zfish    51 GHIKRPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKHMA 115

  Fly   205 EHPDYKYRPRRKPK--NPLTAGPQGGLQM--------QAGGMGQQKLGAGPGAGAG----GYNPF 255
            ::||||||||:|.|  .|:..|.:  |.|        ::.|:..:.|...|.:...    ..|.:
Zfish   116 DYPDYKYRPRKKSKGSTPVKLGEK--LPMKSSKPLPGRSSGLSCKGLKIKPASSKHKMNFSSNKY 178

  Fly   256 HQLPPYFAPSHHLDQGYPVPYFGGFDPLALSK--LHQSQAAAAAAVNNQGQQQGQAP-PQL---P 314
            .......:....:|.....|.....|....|.  |||.     |.|.::.||    | |:|   .
Zfish   179 KSYSESMSDDDTMDVNLESPVTQQDDRNTSSHFVLHQQ-----ATVQSEDQQ----PIPELRVKV 234

  Fly   315 PTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSP-GSSPG-TITPNGMDGS 369
            |.|.:|            |:.:..|.:....:|.|:||.| ||:.| :.||.....|
Zfish   235 PISQTS------------SIQSLSSDSECQAFPESTTSEPRGSTSGRSSTPTSTSSS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
sox12NP_001025449.1 SOX-TCF_HMG-box 52..123 CDD:238684 47/70 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.