DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox7

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:310 Identity:81/310 - (26%)
Similarity:125/310 - (40%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 HSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDE 194
            |......|.|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.|:.::|||:::|
 Frog    30 HRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEE 94

  Fly   195 AKRLRALHMKEHPDYKYRPRRKPK-----------------------NPLTAGPQGGLQMQAGGM 236
            |:|||..||:::|:||||||||.:                       .|.|.|.:..::      
 Frog    95 AERLRVQHMQDYPNYKYRPRRKKQIKRICKRVDTGFLLSSLSRDQNSVPDTRGCRTAVE------ 153

  Fly   237 GQQKLGAGPGAGAGGYNPFHQ-----------------LPPYFAPSHHLDQG---YPVP------ 275
             :::.|..||:.......:.:                 .||..:|...:||.   |..|      
 Frog   154 -KEENGGYPGSALPDMRHYRETPSNGSKHDQTYPYGLPTPPEMSPLEAIDQDQSFYSTPCSEDCH 217

  Fly   276 --------YFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAP 332
                    .:....|:..|.|.|      ..:...|.......|..||...||.|..|:..    
 Frog   218 PHINGAVYEYSSRSPILCSHLSQ------VPIPQTGSSMIPPVPNCPPAYYSSTYHSIHHN---- 272

  Fly   333 SLYAAHSANAA-----GLYPSSSTSSPGSSPGTITPNGMDGSMDSALRRP 377
              |.||....:     ..|.:....|.....|.:..|..|..::::|..|
 Frog   273 --YHAHLGQLSPPPEHPHYDAIDQISQAELLGDMDRNEFDQYLNTSLHDP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 37/70 (53%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 3/10 (30%)
SOX-TCF_HMG-box 41..112 CDD:238684 37/70 (53%)
Sox17_18_mid 171..218 CDD:371880 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.