DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox2

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001102651.1 Gene:Sox2 / 499593 RGDID:1565646 Length:319 Species:Rattus norvegicus


Alignment Length:273 Identity:112/273 - (41%)
Similarity:141/273 - (51%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG---HIKRPMNAFMVWSRLQRRQIAKDNPKM 167
            |.|.:.|..|.|.|:::.         ||...|:.   .:||||||||||||.|||::|::||||
  Rat    13 GPQQASGGGGGGGNATAA---------ATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKM 68

  Fly   168 HNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGP---QGGL 229
            ||||||||||||||||:|:||||||||||||||||||||||||||||||.|..:....   .|||
  Rat    69 HNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGL 133

  Fly   230 QMQAGGMGQQKLGAGPGAGAG---GYNPFHQLPPYFAPSHHLDQ---GYPV-PYFGGFDPLALSK 287
            ....|......:|.|.|.|||   ..:.:..:..:...|:.:.|   |||. |.........:..
  Rat   134 LAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQP 198

  Fly   288 LHQSQAAAA---AAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSS 349
            :|:...:|.   :..::|....|.      ||     ||..||....|.:       |.|...|.
  Rat   199 MHRYDVSALQYNSMTSSQTYMNGS------PT-----YSMSYSQQGTPGM-------ALGSMGSV 245

  Fly   350 STSSPGSSPGTIT 362
            ..|...|||..:|
  Rat   246 VKSEASSSPPVVT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
Sox2NP_001102651.1 SOX-TCF_HMG-box 42..113 CDD:238684 61/70 (87%)
SOXp 112..202 CDD:403523 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.