DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and hbp1

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001008149.2 Gene:hbp1 / 493511 XenbaseID:XB-GENE-950343 Length:541 Species:Xenopus tropicalis


Alignment Length:121 Identity:42/121 - (34%)
Similarity:58/121 - (47%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRR 158
            ||.||..|..||       .|.:|.|.:||..::   ...|||.:   .||||||||::::..|.
 Frog   426 SPRSSQTSCSSL-------CNKTGRNHTSGTANS---VPVTSPNK---CKRPMNAFMLFAKKYRV 477

  Fly   159 QIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPR 214
            :..:..|...|..||..||..||.:...|:|.:..|||.|.....:.:||...|.|
 Frog   478 EYTQMYPGKDNRAISVILGDRWKKMKNEERRIYTIEAKALAEEQKRLNPDCWKRKR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 25/70 (36%)
hbp1NP_001008149.2 AXH 242..362 CDD:369920
SOX-TCF_HMG-box 460..531 CDD:238684 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.