DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox11

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001008053.1 Gene:sox11 / 493415 XenbaseID:XB-GENE-483418 Length:383 Species:Xenopus tropicalis


Alignment Length:294 Identity:94/294 - (31%)
Similarity:136/294 - (46%) Gaps:67/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMK 204
            ||||||||||||||:::||:|.:.:|.|||:|||||||..||:|.:|||.|||.||:|||..||.
 Frog    46 GHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMA 110

  Fly   205 EHPDYKYRPRRKPK-NP-------LTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPY 261
            ::||||||||:||| :|       |...|:...:.::.|....||..|..:|:...:.       
 Frog   111 DYPDYKYRPRKKPKVDPSASKPASLAQSPEKSPKSRSAGKKCPKLKPGSHSGSSSSSG------- 168

  Fly   262 FAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQ------------------ 308
            .|.|..:...|     ||.|.:..|....|:||....::...:::.:                  
 Frog   169 SAKSLTIKSEY-----GGDDYVFGSPKAASKAAKCVFMDEDDEEEEEDEEEDELQIRIKQEEEDE 228

  Fly   309 -----------APPQLPPTSL-----SSFYSGIYSG---------ISAPSLYAAHSANAAGLYPS 348
                       |.|.|..:|.     :|.|..:.:|         |:..|.....:...|....|
 Frog   229 PLRQYNVAKVPASPTLSSSSAESAEGASMYEDVRNGTRLYYNFKNITKQSTIPQATITLAPAPRS 293

  Fly   349 SSTSSPGSSPGTITPNGMDGSMDSALRR-PVPVL 381
            :.|:||.|....:.   .|.|::...:. |||.|
 Frog   294 AGTTSPSSHKDELM---FDLSLNFTQQNPPVPEL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
sox11NP_001008053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SOX-TCF_HMG-box 47..118 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..174 19/65 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..231 0/33 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.