DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox102F

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:357 Identity:107/357 - (29%)
Similarity:147/357 - (41%) Gaps:93/357 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PNYGFHLGQAQGLEDYAPQSQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNGPAGQGVNGSSGMGH 72
            |...:|.||....|...|   |..|.|      ||  ::.::|..|||......:....|.|...
  Fly   321 PPLSWHQGQPHYAEIELP---LLKSHG------RV--WNSAVACSGGSRATRVSRDSVNSCGTNS 374

  Fly    73 HMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPG 137
            ..|:.:.|..::.........||:          ||.....||.|...:.||    :||      
  Fly   375 ERSAALDPESLNSGQLGPVPASPS----------SQPLRQGNGHGHGGNHGH----VHS------ 419

  Fly   138 QEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALH 202
             :.||||||||||||::.:||:|.|..|.||||.|||.|||.||.::.::|:|:.:|..||..||
  Fly   420 -KPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLH 483

  Fly   203 MKEHPDYKYRPRRKPKNPLTAGPQ------------------------GGLQMQAGGMGQQKLGA 243
            |::||||:||||.| :..:..|.:                        ||:   :||.|.....|
  Fly   484 MEQHPDYRYRPRPK-RTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGV---SGGSGSLCADA 544

  Fly   244 GPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQ 308
            .| .|:||.|....:                       ..|.:..|....|::||....|...|.
  Fly   545 CP-KGSGGSNSQVAV-----------------------AAAAAVYHLQDMASSAASTAHGHDCGH 585

  Fly   309 APPQ---LPPTSLSSFYSGIYSGISAPSLYAA 337
            .|||   .||.|||.      ||.|:..:..|
  Fly   586 TPPQQFFYPPESLSP------SGFSSDEVELA 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 41/70 (59%)
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.