DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox1a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001002483.1 Gene:sox1a / 436756 ZFINID:ZDB-GENE-040718-186 Length:336 Species:Danio rerio


Alignment Length:354 Identity:125/354 - (35%)
Similarity:156/354 - (44%) Gaps:126/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG----------HIKRPMNAFMVWSRLQRR 158
            |:..::.|.|.|...|              |:|||.|          .:||||||||||||.|||
Zfish     3 SMMMETDLHSPGPQTN--------------TNPGQTGPNSGSKANQDRVKRPMNAFMVWSRGQRR 53

  Fly   159 QIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK----- 218
            ::|::||||||||||||||||||:::|:||||||||||||||:|||||||||||||||.|     
Zfish    54 KMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKK 118

  Fly   219 ------NPLTAGPQGGLQMQAGGMGQQ---KLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPV 274
                  ..|..|..||:.|...|:||:   ..|.|..|.||           :|   |:: |:..
Zfish   119 DKYSLAGGLLGGAGGGVGMSPAGVGQRLESPGGHGSSASAG-----------YA---HMN-GWAN 168

  Fly   275 PYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPP---------------------------- 311
            ..:.|         ..:.||||||:..:.|......|                            
Zfish   169 GTYSG---------QVAAAAAAAAMMQEAQLAYSQHPGSGSHHHHAHHHHPHNPQPMHRYDMTAL 224

  Fly   312 QLPPTSLSSFY-----SGIYSGISAPSLYAAHSANAA-----------------GLYPSSSTSSP 354
            |..|.|.|..|     || |.|||    |..|..::.                 .:.|..:|.|.
Zfish   225 QYSPISNSQSYMSASPSG-YGGIS----YTQHQNSSVATPAAIGTLSSLVKSEPNISPPVTTHSR 284

  Fly   355 GSSPGTI-------TPNGMDG--SMDSAL 374
            |..||.:       .|.|..|  |:.|.|
Zfish   285 GPCPGDLREMISMYLPTGESGDPSVQSRL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 58/70 (83%)
sox1aNP_001002483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 10/49 (20%)
SOX-TCF_HMG-box 36..107 CDD:238684 58/70 (83%)
SOXp 106..>194 CDD:289133 31/111 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..216 1/22 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.