DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox2

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_998869.1 Gene:sox2 / 407873 XenbaseID:XB-GENE-484553 Length:311 Species:Xenopus tropicalis


Alignment Length:314 Identity:115/314 - (36%)
Similarity:148/314 - (47%) Gaps:85/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEI 172
            |:|.|::.||.|:.|          ..||.:   :||||||||||||.|||::|::|||||||||
 Frog    16 QASGGNSNSGSNNQS----------KNSPDR---VKRPMNAFMVWSRGQRRKMAQENPKMHNSEI 67

  Fly   173 SKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK------------------- 218
            |||||||||||:|:||||||||||||||||||||||||||||||.|                   
 Frog    68 SKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGA 132

  Fly   219 NPLTAGPQGGLQMQAG-------------------GMGQQKLGAGPGAGAGGYNPFHQLPPYFAP 264
            ||:|:|.  |..:.||                   ||.|::||.....|...:|     .|...|
 Frog   133 NPMTSGV--GASLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLGYPQHPGLSAHN-----APQMQP 190

  Fly   265 SHHLD--------QGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQG----QQQGQAPPQLPPTS 317
            .|..|        ......|..|....::|  :..|.|...::.:.|    .:...:||.:..:|
 Frog   191 MHRYDVSALQYNSMSSSQTYMNGSPTYSMS--YSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSS 253

  Fly   318 ----------LSSFYSGIYSGISAPSLYAAHSANAAGLYPSSS---TSSPGSSP 358
                      |....|....|...|...|....:.:..|.|:|   |:..|:.|
 Frog   254 HSRAPCQAGDLRDMISMYLPGAEVPEPAAQSRLHMSQHYQSASVAGTAINGTLP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
sox2NP_998869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 10/36 (28%)
SOX-TCF_HMG-box 36..107 CDD:238684 61/73 (84%)
SOXp 106..194 CDD:372055 24/94 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..259 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.