DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox21b

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:264 Identity:108/264 - (40%)
Similarity:130/264 - (49%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||||.|||::|::||||||||||||||||||||.||||||||||||||||:||||
Zfish     7 HVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKE 71

  Fly   206 HPDYKYRPRRKPKN---------PLT-------AGPQGGLQMQAGGMGQ------QKLGAGPGAG 248
            |||||||||||||.         |:.       |...|||  .||.:.:      .|..|...|.
Zfish    72 HPDYKYRPRRKPKTLMKKDKFAFPVAYNLGEHEALKVGGL--PAGALTESLMSNPDKAAAAAAAA 134

  Fly   249 AGG--YNPFHQLPPY--FAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQA 309
            |..  :||.....||  |.....:.:..| |.|....||..                        
Zfish   135 AARVFFNPSMSANPYSFFDLGSKMTELSP-PSFSYASPLGY------------------------ 174

  Fly   310 PPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSAL 374
                 ||:.::| ||...|       .||:       .:.|..||| :||.:.|........:.|
Zfish   175 -----PTAATAF-SGAVGG-------GAHT-------HTHSHPSPG-NPGYMIPCNCAAWPSAGL 218

  Fly   375 RRPV 378
            :.|:
Zfish   219 QPPL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 62/70 (89%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 62/70 (89%)
SOXp 77..>95 CDD:289133 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.