DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox17a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_989425.1 Gene:sox17a / 395066 XenbaseID:XB-GENE-484295 Length:383 Species:Xenopus tropicalis


Alignment Length:311 Identity:90/311 - (28%)
Similarity:131/311 - (42%) Gaps:107/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LGSNGSG-LNSSSGHQSAGMHSLATSPGQ-EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEIS 173
            :.|.|.| |.|.:|.        |.|.|: |..|:|||||||||::.:|:::|:.||.:||:|:|
 Frog    36 MNSLGEGKLKSDAGS--------ANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELS 92

  Fly   174 KRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK------------------PKNP 220
            |.||..||.|..:|||||::||:|||..||::||:|||||||:                  |...
 Frog    93 KMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRADTGFMHMAEPPES 157

  Fly   221 LTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYN----PFHQLPPYFAPSHHLDQGYPVPYFGGF- 280
            ...|..|.:.:::..:              ||:    |..|||   ..||:.:.....|::.|: 
 Frog   158 AVLGTDGRMCLESFSL--------------GYHEQTYPHSQLP---QGSHYREPQAMAPHYDGYS 205

  Fly   281 ------DPLAL-------------------------SKLHQSQAAAAAAVNN--QGQQQGQAPPQ 312
                  .||.|                         |..||..:.|:..|..  |.:|.||..| 
 Frog   206 LPTPESSPLDLAEADPVFFTSPPQDECQMMPYSYNASYTHQQNSGASMLVRQMPQAEQMGQGSP- 269

  Fly   313 LPPTSLSSFYSGIYSGISAPSLY---------AAHSANAAGLYPSSSTSSP 354
                     ..|:....|:|.:|         |.|..     .|.:..:||
 Frog   270 ---------VQGMMGCQSSPQMYYGQMYLPGSARHHQ-----LPQAGQNSP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 40/70 (57%)
sox17aNP_989425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..58 9/28 (32%)
SOX-TCF_HMG-box 60..131 CDD:238684 40/70 (57%)
Sox17_18_mid 191..239 CDD:371880 5/47 (11%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:Q3KQ35 332..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.