DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox17b.1

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_988849.1 Gene:sox17b.1 / 394440 XenbaseID:XB-GENE-484865 Length:376 Species:Xenopus tropicalis


Alignment Length:291 Identity:88/291 - (30%)
Similarity:130/291 - (44%) Gaps:68/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ATSPGQ-EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAK 196
            |.|.|: |..|:|||||||||::.:|:::|:.||.:||:|:||.||..||.|..:.||||::||:
 Frog    48 ANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAE 112

  Fly   197 RLRALHMKEHPDYKYRPRRK--------------PKNPLTAGPQ---------GGLQMQAGGMGQ 238
            |||..|::::||||||||||              |...: .|||         ...:||..|...
 Frog   113 RLRVQHIQDYPDYKYRPRRKKQVKRMKREEEGFLPSADI-PGPQVMGCNAMVGQNYKMQYSGQNS 176

  Fly   239 QKLGAGPGAGAGGYNPF-HQLPPYFAPSHHLDQGYPV----PYFGGFDPLAL----SKLHQSQAA 294
            |:....|......:||. :....|..|.:::.|...|    |..|.:..|:.    |.:...|.|
 Frog   177 QQSQITPAGYFEDHNPVGYYYRGYNVPEYYMSQNSSVTCGPPAQGEYQALSYNFNSSYIPYQQNA 241

  Fly   295 AAAAVNNQ--------------GQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGL 345
            :|.|:..|              |....|..||:            |:|    .:|....|....:
 Frog   242 SAPAMGKQMAVKENIIQESPEHGIMGCQVSPQM------------YNG----QMYVPECAKTHPV 290

  Fly   346 YPSSSTSSPGSSPGTIT----PNGMDGSMDS 372
            ..:...||...|...:|    |:..||.::|
 Frog   291 AQTEQHSSLHQSQQMVTQNYLPSQQDGHLES 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
sox17b.1NP_988849.1 SOX-TCF_HMG-box 57..128 CDD:238684 38/70 (54%)
PABP-1234 <80..250 CDD:130689 55/170 (32%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:O42601 327..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.