DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox7

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001074219.1 Gene:sox7 / 394203 ZFINID:ZDB-GENE-040109-4 Length:390 Species:Danio rerio


Alignment Length:305 Identity:92/305 - (30%)
Similarity:137/305 - (44%) Gaps:73/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESE 187
            ||.|   |........|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.|...:
Zfish    27 GHTS---HRAPADKVSEPRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTPPQ 88

  Fly   188 KRPFIDEAKRLRALHMKEHPDYKYRPRRKPK-------------------------------NPL 221
            |||:::||:|||..||:::|:||||||||.:                               :||
Zfish    89 KRPYVEEAERLRVQHMQDYPNYKYRPRRKKQLKRICKRVDPGFLLTTLGPDQNSLPDPRGCCHPL 153

  Fly   222 TAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPL-AL 285
            ....:.|:   :||.|      .|||...|...|..  |..:.|......|.:|......|| |:
Zfish   154 DKDDESGV---SGGFG------SPGAALPGVRVFRD--PASSNSSFDTYPYGLPTPPEMSPLDAV 207

  Fly   286 SKLHQSQAAAAAAVNNQGQQQGQAPPQ---LPPTSLSS--FYSGIYSGISAPSLYA-------AH 338
            ...|||..:::::|:........:.|:   ..|..:||  .|...||..:|  |::       :|
Zfish   208 DHEHQSYYSSSSSVSTSSCSSSNSCPEDRRPTPAHMSSPPPYHPDYSQQAA--LHSHLGHIPMSH 270

  Fly   339 SANAAGLY--PSSSTSSPGSSP----------GTITPNGMDGSMD 371
            .|:.|.|.  |..|..|| |.|          |.::|....|.::
Zfish   271 QASGATLIAGPPLSYYSP-SFPQVHIHHQGHLGQLSPPPEQGHLE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 37/70 (53%)
sox7NP_001074219.1 SOX-TCF_HMG-box 42..113 CDD:238684 37/70 (53%)
Sox_C_TAD 174..388 CDD:288887 35/146 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.