DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox4b

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_957195.1 Gene:sox4b / 393875 ZFINID:ZDB-GENE-040426-1274 Length:342 Species:Danio rerio


Alignment Length:318 Identity:107/318 - (33%)
Similarity:148/318 - (46%) Gaps:72/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQ----------------EGHIKRPMNAFMVWS 153
            |...||..:...|.:|.||......|:.:.|||.                .||||||||||||||
Zfish     2 LQRSSSSSALFDGDSSDSGALDLDAHAASPSPGSTASGGEKLNPGWCKTASGHIKRPMNAFMVWS 66

  Fly   154 RLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK 218
            :::||:|.:.:|.|||:|||||||..||||.:.:|.|||.||:|||..||.::||||||||:|.|
Zfish    67 QIERRKIMEQSPDMHNAEISKRLGKRWKLLKDGDKIPFIREAERLRLKHMADYPDYKYRPRKKVK 131

  Fly   219 NPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPL 283
               ::|.:...::.......:|..||        .| |:..|..|..|.|.:....|.... .|.
Zfish   132 ---SSGSKPSEKLSISKPSSKKRSAG--------KP-HKKEPGPADHHSLYKAKAAPVVKQ-SPE 183

  Fly   284 ALSKLH---QSQAAAAAAVNNQGQQQGQAPPQL-------PPTSLSSFYSGI--------YSGIS 330
            ...:|:   .|.:.:.|||        .|.|.|       .|.||....||.        |:|.|
Zfish   184 KKKRLYIFSSSSSPSPAAV--------PASPTLSSSADTSDPLSLYEDASGSGKEDADTRYTGSS 240

  Fly   331 ----APSLYAAHSANAAGLYPSS----------STSSPG---SSPGTITPNGMDGSMD 371
                :|:..||||::::....||          :.:|||   .|.|:|..:.:|...|
Zfish   241 MRAPSPTPSAAHSSSSSQFSSSSDEEPDDDALDANTSPGFDSMSLGSIGSSVLDRDFD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 46/70 (66%)
sox4bNP_957195.1 SOX-TCF_HMG-box 54..125 CDD:238684 46/70 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.