DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox8b

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001020636.1 Gene:sox8b / 386704 ZFINID:ZDB-GENE-031114-1 Length:358 Species:Danio rerio


Alignment Length:252 Identity:86/252 - (34%)
Similarity:119/252 - (47%) Gaps:68/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||::..||::|...|.:||:|:||.||..|:||.|||||||::||:|||..|.|:
Zfish    85 HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLTESEKRPFVEEAERLRVQHKKD 149

  Fly   206 HPDYKYRP-RRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFH-----------QL 258
            ||||||:| |||...|..|..:.|.::.     |....|.||.|....:|.|           ..
Zfish   150 HPDYKYQPRRRKSVKPGHAESEAGSELM-----QHMYKAEPGMGRLTGSPDHITDHTGHTHGPPT 209

  Fly   259 PPYF-------APSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNN--------------- 301
            ||..       ||..::|          |..:.:|:|      :...:.|               
Zfish   210 PPTTPKTEHPQAPKQNID----------FSNVDISEL------STDVIGNLTFDLQEFDQYLPLT 258

  Fly   302 --QGQQQGQAPP---QLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSS 353
              ||....:|||   .|.|..:.     |.:...:|..|:.||:.   ||.|||:|:
Zfish   259 PDQGACSRRAPPAGAHLHPQRVH-----IKTEQRSPQHYSEHSST---LYSSSSSSA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 44/70 (63%)
sox8bNP_001020636.1 Sox_N 1..75 CDD:289229
SOX-TCF_HMG-box 85..155 CDD:238684 43/69 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.