DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox2

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_998283.1 Gene:sox2 / 378723 ZFINID:ZDB-GENE-030909-1 Length:315 Species:Danio rerio


Alignment Length:273 Identity:118/273 - (43%)
Similarity:144/273 - (52%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLG 177
            :.|:|..:|||:..      ..||.:   |||||||||||||.|||::|::||||||||||||||
Zfish    18 TGGTGNTNSSGNNQ------KNSPDR---IKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLG 73

  Fly   178 AEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGP---QGGLQMQAGGMGQQ 239
            ||||||:||||||||||||||||||||||||||||||||.|..:....   .||| :..||.|  
Zfish    74 AEWKLLSESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGL-LAPGGNG-- 135

  Fly   240 KLGAGPGAGAG---GYNPFHQLPPYFAPSHHLD-------------QGYPV-PYFGGFDPLALSK 287
             :|||.|.|||   |.|  .::..|    .|::             .|||. |.....:...:..
Zfish   136 -MGAGVGVGAGLGAGVN--QRMDSY----AHMNGWTNGGYGMMQEQLGYPQHPSLNAHNTAQMQP 193

  Fly   288 LHQSQAAAA---AAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSS 349
            :|:...:|.   :..|:|....|.      ||     ||..||..|.|.:       ..|...|.
Zfish   194 MHRYDMSALQYNSMTNSQTYMNGS------PT-----YSMSYSQQSTPGM-------TLGSMGSV 240

  Fly   350 STSSPGSSPGTIT 362
            ..|...|||..:|
Zfish   241 VKSESSSSPPVVT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 63/70 (90%)
sox2NP_998283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 9/31 (29%)
SOX-TCF_HMG-box 37..108 CDD:238684 63/73 (86%)
SOXp 107..197 CDD:289133 29/99 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..263 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.