DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox14

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:176 Identity:71/176 - (40%)
Similarity:101/176 - (57%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSL---GS 107
            |.|......:|..|.......:....|..|.|.:|......:..::  ||:.| |...:|   |.
  Fly    93 SPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGER--SPSHS-GHEMTLSMDGI 154

  Fly   108 QSSL--GSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNS 170
            .|||  ||....:|||:.:..|    ..|.....||||||||||||||:::||:|.:..|.:||:
  Fly   155 DSSLVFGSARVPVNSSTPYSDA----TRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNA 215

  Fly   171 EISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            ||||.||..|:||::.:|:|:|.||::||.|||.|:|:|||||::|
  Fly   216 EISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 47/77 (61%)
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 45/74 (61%)

Return to query results.
Submit another query.