DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox14

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:176 Identity:71/176 - (40%)
Similarity:101/176 - (57%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSL---GS 107
            |.|......:|..|.......:....|..|.|.:|......:..::  ||:.| |...:|   |.
  Fly    93 SPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGER--SPSHS-GHEMTLSMDGI 154

  Fly   108 QSSL--GSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNS 170
            .|||  ||....:|||:.:..|    ..|.....||||||||||||||:::||:|.:..|.:||:
  Fly   155 DSSLVFGSARVPVNSSTPYSDA----TRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNA 215

  Fly   171 EISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            ||||.||..|:||::.:|:|:|.||::||.|||.|:|:|||||::|
  Fly   216 EISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 42/70 (60%)
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 42/70 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.