DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox4a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_998287.1 Gene:sox4a / 336346 ZFINID:ZDB-GENE-030131-8290 Length:363 Species:Danio rerio


Alignment Length:323 Identity:99/323 - (30%)
Similarity:148/323 - (45%) Gaps:86/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 HQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGS---GLNSSSGHQSAGMHSLATSPGQEGHIKRP 145
            |.:.|:...:.|..||.|     .:..|..:.|   |..:|:|.:.    .:|......||||||
Zfish    12 HTSSSSSSDVLPGDSIDS-----GEMDLDMDASPTPGSPNSAGDKM----DIAWCKTPSGHIKRP 67

  Fly   146 MNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYK 210
            ||||||||:::||:|.:.:|.|||:|||||||..||||.:|:|.|||.||:|||..||.::||||
Zfish    68 MNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYK 132

  Fly   211 YRPRRKPKNPLTAGPQGGLQMQAGGMGQ--QKLGAGPGAGAGG------YNPFH------QLPPY 261
            ||||:|.|:            .:|..|:  :::.|.|||.:..      .:..|      :|..:
Zfish   133 YRPRKKVKS------------SSGKTGEKAERVSASPGAKSASKKSSKTLSRTHRKSTTLELTSH 185

  Fly   262 FAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLP--PTSLSSFYSG 324
            ..|:.|                  ..|::|::.:||             .|:|  |......|.|
Zfish   186 SVPADH------------------HALYKSRSVSAA-------------KQIPEKPAKRGHVYGG 219

  Fly   325 IYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSA--------LRRPVP 379
            ..:..|.||:       |....|:.|:|:..|.|.::..:|:....:.|        .|.|.|
Zfish   220 CSTDSSPPSV-------AVPASPTLSSSAESSDPLSLYEDGLASGKEDAEPAARFKYTRAPSP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
sox4aNP_998287.1 SOX-TCF_HMG-box 63..134 CDD:238684 47/70 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.