DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox18

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:305 Identity:96/305 - (31%)
Similarity:137/305 - (44%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSP------GQEG------------H 141
            |.|....|.:.|..::....|..:.:.|....|...||..||      |:.|            .
  Rat    14 PPSRRDCAWAPGLGAAAEPRGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGERQTADELR 78

  Fly   142 IKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEH 206
            |:|||||||||::.:|:::|:.||.:||:.:||.||..||.|..:|||||::||:|||..|:::|
  Rat    79 IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDH 143

  Fly   207 PDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGP-GAGAGGYNPFHQLPPYFAPSHHLDQ 270
            |:||||||||.:.......:.||.:.  |:.|......| .|.:|....|.:||...|....|  
  Rat   144 PNYKYRPRRKKQARKVRRLEPGLLLP--GLVQPSAPPEPFAAASGSARSFRELPTLGAEFDGL-- 204

  Fly   271 GYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQA---PPQLPP--TSLSSFY-------- 322
            |.|.|.....|                     |.:.|:|   ||.|.|  .:|.:|.        
  Rat   205 GLPTPERSPLD---------------------GLESGEASFFPPPLAPEDCALRAFRAPYAPELA 248

  Fly   323 ---SGIYSGISAPSLYAA-HSANAAGLYPSSSTSSPGSSPGTITP 363
               |..|....|.:|..| .:|..|||| ..:..:||..|..::|
  Rat   249 RDPSFCYGSSLAEALRTAPPAAPLAGLY-YGTLGTPGPFPNPLSP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Sox17_18_mid 191..239 CDD:403331 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.