DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Cic

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001359008.1 Gene:Cic / 308435 RGDID:1310706 Length:2513 Species:Rattus norvegicus


Alignment Length:511 Identity:111/511 - (21%)
Similarity:154/511 - (30%) Gaps:210/511 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSG 117
            |..|..|.|.....|.|.|        |......|...::|.|.:...:.|..| :..|.|    
  Rat   997 GADPGRPPGATCPESPGPG--------PPLTLGGVDPGKSLPPTTEEEAPGPPG-EPRLDS---- 1048

  Fly   118 LNSSSGHQSAGMH------SLATSPG----------------------------QEGHIKRPMNA 148
             .:.|.|..|.:.      .|...||                            ::.||:|||||
  Rat  1049 -ETESDHDDAFLSIMSPEIQLPLPPGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNA 1112

  Fly   149 FMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKY-- 211
            ||::|:..|..:.:.:|...|..:||.||..|..|...||:.:.|.|.:::..|.|.|||:|:  
  Rat  1113 FMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCN 1177

  Fly   212 RPRRKPKN---PLTAGPQGGLQ------------MQAGGMGQQKLGA-----------GPGAGAG 250
            :.|:|..:   |.:.|..||.:            ..|.|:..:.|.|           .||:|..
  Rat  1178 KDRKKSSSEAKPASLGLAGGHKETRERSMSETGTAAAPGVSSELLSAAAQTLLSSDTKAPGSGPC 1242

  Fly   251 GYNPFHQL-------PPYFAPS--HHLDQG-----------------------YPVPYFG----- 278
            |....|.:       |..|:.|  |.||.|                       .|.|.:|     
  Rat  1243 GAERLHAVGGPGSARPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPTSFSGPKPSPQYGAPGSF 1307

  Fly   279 ------------GFDPLALSKLHQSQAAAAAAV-------------------------------- 299
                        |..||..|:..:||.||:..:                                
  Rat  1308 AAPGEGGNLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDSFGTTDIDLK 1372

  Fly   300 -------NNQGQQQGQAP--------------------------------PQLPPTSLSSFYSGI 325
                   :..|...|:.|                                |..||.:.|..|...
  Rat  1373 CKERVTDSESGDSSGEDPEGNKGFGRKVFSPVIRSSFTHCRPTLDPEPPGPPDPPAAFSKGYGPT 1437

  Fly   326 YSGISAPSLYAAHSANAAGLYPSSSTS-SPGSSPGTI-TPNGMDGSMDSALRRPVP 379
            .|..|:|          |....|.||| |.||  ||. |.....||....||.|.|
  Rat  1438 PSSSSSP----------ASTSVSVSTSFSLGS--GTFKTQESGQGSTAVPLRPPPP 1481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 29/72 (40%)
CicNP_001359008.1 DUF4819 252..346 CDD:374357
PHA03247 <749..1060 CDD:223021 18/76 (24%)
NHP6B <1077..1221 CDD:227935 37/143 (26%)
SOX-TCF_HMG-box 1105..1176 CDD:238684 29/70 (41%)
PRK07003 <1552..>1694 CDD:235906
PHA03247 <1638..2180 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.