DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and lef1

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571501.1 Gene:lef1 / 30701 ZFINID:ZDB-GENE-990714-26 Length:365 Species:Danio rerio


Alignment Length:212 Identity:47/212 - (22%)
Similarity:80/212 - (37%) Gaps:63/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GHH------MSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQS-------------SLGSNGS 116
            |||      ..:.|..||....:.....|||       |.:|..:             ..|.:.:
Zfish   168 GHHPQDVNPKQAGMPRHHPGPDIPNFYPLSP-------GGVGQMTPPLGWFSHHMVPGPPGPHAT 225

  Fly   117 GL--------NSSSGHQSAGMHSLATSPGQE---------GHIKRPMNAFMVWSRLQRRQIAKDN 164
            |:        .....|.:..||   ..|..|         .|||:|:||||::.:..|..:..:.
Zfish   226 GIPHPAIVNPQVKQEHDTDLMH---MKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAEC 287

  Fly   165 PKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDY-------KYRPRRKPKNPLT 222
            ....::.|::.||..|..|:..|:..:.:.|::.|.|||:.:|.:       |.:.|::.|    
Zfish   288 TLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREK---- 348

  Fly   223 AGPQGGLQMQAGGMGQQ 239
                  :|..|.|.||:
Zfish   349 ------IQEPASGTGQR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 22/77 (29%)
lef1NP_571501.1 CTNNB1_binding 1..210 CDD:285538 11/48 (23%)
SOX-TCF_HMG-box 264..335 CDD:238684 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.