DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox11b

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571412.1 Gene:sox11b / 30603 ZFINID:ZDB-GENE-980526-466 Length:368 Species:Danio rerio


Alignment Length:92 Identity:56/92 - (60%)
Similarity:71/92 - (77%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMK 204
            ||||||||||||||:::||:|.:.:|.|||:|||||||..||:|.:|||.|||.||:|||..||.
Zfish    44 GHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLQHMA 108

  Fly   205 EHPDYKYRPRRKPK-----NPLTAGPQ 226
            ::|||||||::|||     .|....|:
Zfish   109 DYPDYKYRPKKKPKLDSSSKPAVQSPE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 54/83 (65%)
sox11bNP_571412.1 HMG-box_SoxC_SOX11 35..126 CDD:438846 54/81 (67%)

Return to query results.
Submit another query.