DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox11a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571411.1 Gene:sox11a / 30602 ZFINID:ZDB-GENE-980526-395 Length:354 Species:Danio rerio


Alignment Length:279 Identity:89/279 - (31%)
Similarity:130/279 - (46%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMK 204
            ||||||||||||||:::||:|.:.:|.|||:|||||||..||:|.:|||.|||.||:|||..||.
Zfish    39 GHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMA 103

  Fly   205 EHPDYKYRPRRKPK-----NPLTAGPQGGLQMQAGGMGQQKLGA---GPGAGAGGYNPFHQL-PP 260
            ::|||||||::|||     .|....|:...:.........||.|   |..:.:.||...:.. ..
Zfish   104 DYPDYKYRPKKKPKLDSSSKPSAPSPEKCSKTSKSSKKCPKLKANKTGSKSSSHGYGDEYAFKST 168

  Fly   261 YFAPSHHLDQGY-----------------------PVPYFGGFDPLALSKLHQSQAAAAAAV--- 299
            ..:.:.|:...:                       |:..:......|...|..|..:..|::   
Zfish   169 KVSKTVHIKSEFTDEDDDDDSEEDSRVRVKEEEEDPIRAYNVAKVPASPTLSSSTESEGASMYEE 233

  Fly   300 --NNQ--------GQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSP 354
              ||:        .:|....|..:.|.|..|..:...|...|..|....|.|.|.   |:.:|..
Zfish   234 VRNNRLYYNFKNITKQSTMYPASVSPASSRSVSTSSSSSEDADDLLFDFSLNFAS---SAQSSEL 295

  Fly   355 GS-SPGTITPNGMDGSMDS 372
            || :||.::.:.:|..::|
Zfish   296 GSQNPGNLSLSLVDKELES 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
sox11aNP_571411.1 SOX-TCF_HMG-box 40..107 CDD:238684 43/66 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.