DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox21a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571361.1 Gene:sox21a / 30543 ZFINID:ZDB-GENE-990715-6 Length:239 Species:Danio rerio


Alignment Length:270 Identity:106/270 - (39%)
Similarity:135/270 - (50%) Gaps:78/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||||.|||::|.|||||||||||||||.|||||::|||||||||||||||:||||
Zfish     7 HVKRPMNAFMVWSRAQRRKMALDNPKMHNSEISKRLGGEWKLLSDSEKRPFIDEAKRLRAVHMKE 71

  Fly   206 HPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQ 270
            ||||||||||||||.:..                             :.:|     |..:::|.:
Zfish    72 HPDYKYRPRRKPKNLIKK-----------------------------DRYH-----FNVTYNLGE 102

  Fly   271 GYPVPYFGGFDPL------------ALSKLHQSQAAAAAAV----------------NNQGQQQG 307
            |         |||            :||....|.||||..|                |::..:..
Zfish   103 G---------DPLKSARLSGDALSDSLSAEKTSVAAAATRVFFSHHLSANPYPFLDLNSKISELP 158

  Fly   308 QAPPQLPPTSLSSFYSGIYS----GISAPSLYAAHSANAAG-LYPSSSTSSPGSSPGTITPNGMD 367
            .||  .|..|:..:.||:.:    |:.|.:.:|..||.:.| :.|.:....|||.|...:...:.
Zfish   159 PAP--FPHYSVLGYPSGLPAFPGMGVLAGAPHAHPSAGSPGHMLPYNCLGWPGSGPAVPSSYVLL 221

  Fly   368 GSMDSALRRP 377
            ..|..|...|
Zfish   222 PGMTKAQHEP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
sox21aNP_571361.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.