DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox3

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001001811.2 Gene:sox3 / 30529 ZFINID:ZDB-GENE-980526-333 Length:300 Species:Danio rerio


Alignment Length:301 Identity:116/301 - (38%)
Similarity:146/301 - (48%) Gaps:75/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEI 172
            ||:.||...|.|:|:..|.              .:||||||||||||.|||::|::|||||||||
Zfish    15 QSNTGSVTGGKNNSANDQD--------------RVKRPMNAFMVWSRGQRRKMAQENPKMHNSEI 65

  Fly   173 SKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGP---QGGLQMQAG 234
            ||||||:||||.::||||||||||||||:|||||||||||||||.|..|....   .|||     
Zfish    66 SKRLGADWKLLTDAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLPGGL----- 125

  Fly   235 GMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPY--FGGFDPLALSKLHQSQAA--A 295
                    ..|||.              |.::.:..|..:.|  ..|:...|.| |.|.|.|  .
Zfish   126 --------LAPGAN--------------AVNNAVSVGQRMDYTHMNGWTNSAYS-LMQDQLAYPQ 167

  Fly   296 AAAVNNQGQQQ----GQAPPQLPPTSLSSFYSGIYSGISAPS-LYAAHSANAAGLYPSSST--SS 353
            ..::|:...||    ..|..|.|..|.:..|....|..|:.| .|...:::|.||...:|.  :.
Zfish   168 HPSMNSPQIQQMHRYDMAGLQYPMMSTAQTYMNAASTYSSMSPAYTQQTSSAMGLGSMASVCKTE 232

  Fly   354 PGSSPGTIT-------------------PNGMDGSMDSALR 375
            |.|.|..||                   |.|.|.:..|:|:
Zfish   233 PSSPPPAITSHSQRACLGDLRDMISMYLPPGGDSADHSSLQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 58/70 (83%)
sox3NP_001001811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 8/33 (24%)
SOX-TCF_HMG-box 34..105 CDD:238684 58/70 (83%)
SOXp 104..182 CDD:289133 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.