DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and tcf7l1a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571344.1 Gene:tcf7l1a / 30523 ZFINID:ZDB-GENE-980605-30 Length:560 Species:Danio rerio


Alignment Length:370 Identity:94/370 - (25%)
Similarity:135/370 - (36%) Gaps:75/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LEDYAPQSQLQLSPGMDMDIKRVLHYSQSLAAMGGS------PNG-----PA-GQGVNGSSGMGH 72
            |..|.|     ||||.   :.::.|....|....|.      |.|     || ....:.||.:..
Zfish   213 LSPYYP-----LSPGA---VGQIPHPLGWLVPQQGQHMYSIPPGGFRHPYPALAMNASMSSLVSS 269

  Fly    73 HMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPG 137
            ..|.||.||..|   ...||..|:.:|.|...  .|...|.:.|  ||:.|..|.   .:.....
Zfish   270 RFSPHMVPHPPH---GLHQTGIPHPAIVSPAI--KQEPNGESPS--NSTHGKPSV---PVKKEEE 324

  Fly   138 QEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALH 202
            ::.|||:|:||||::.:..|.::..:.....::.|::.||..|..|:..|:..:.:.|::.|.||
Zfish   325 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLH 389

  Fly   203 MKEHPDY----KYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFA 263
            .:.:|.:    .|..|:|.|....:.                   .|........|..|..||.:
Zfish   390 SQLYPGWSARDNYGKRKKRKRDCKSD-------------------SPSESNFSPQPKKQCVPYLS 435

  Fly   264 PSHHLDQGYPVPYFGGF--DPLALSKLHQSQAAAAAAVNNQGQ-------QQGQAPPQLPPTSLS 319
            .....|.  |....|..  .|...|....|.||.||..:.|.|       .:|:|....|...|.
Zfish   436 SEKMCDS--PTSSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEGRAHHNHPHFPLP 498

  Fly   320 SFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPN 364
            ...||..||    |..|.||.:.    |...||.|   |..:.||
Zfish   499 GKSSGSGSG----SSMALHSLSR----PIPFTSLP---PSLLGPN 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 20/74 (27%)
tcf7l1aNP_571344.1 CTNNB1_binding 1..233 CDD:285538 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..328 7/37 (19%)
SOX-TCF_HMG-box 328..399 CDD:238684 20/70 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..513 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.