DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox8

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100459.1 Gene:Sox8 / 302993 RGDID:1309072 Length:463 Species:Rattus norvegicus


Alignment Length:344 Identity:103/344 - (29%)
Similarity:148/344 - (43%) Gaps:66/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HYSQSLAAMGGSPNGPAGQGVNGSSGMGH--HMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLG 106
            |...|.:....||.|..|.|..|..|.|.  ..:....|..:..|||  |.|.     |...||.
  Rat    24 HVEDSDSDAPPSPAGSEGLGRAGGGGRGDTAEAADERFPACIRDAVS--QVLK-----GYDWSLV 81

  Fly   107 SQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSE 171
            .....|..|..|.:                  :.|:||||||||||::..||::|...|.:||:|
  Rat    82 PMPVRGGGGGTLKA------------------KPHVKRPMNAFMVWAQAARRKLADQYPHLHNAE 128

  Fly   172 ISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGM 236
            :||.||..|:||:|||||||::||:|||..|.|:||||||:|||: |:..|    |.....:|  
  Rat   129 LSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRR-KSVKT----GRSDSDSG-- 186

  Fly   237 GQQKLGAGPGAGAGGYNPFHQLPPYFAPSH-HLD-----QGYPVPYFGGFDPLALSKLHQSQAAA 295
              .:||..||      .|.::.......:| |.|     .|.|.|     .....:.|||:...:
  Rat   187 --TELGHHPG------GPMYKTDTVLGDAHRHSDHTGQTHGPPTP-----PTTPKTDLHQASNGS 238

  Fly   296 AAAVNNQGQQ---QGQAPPQLPPTSLSSFYSGIYSGISAPSLYA--------AHSANAAGLYPSS 349
            ...:..:|::   .|:.........:|...|.:.|.:....::.        .|||.|.  .||.
  Rat   239 KQELRLEGRRLVDSGRQNIDFSNVDISELSSEVISNMDTFDVHEFDQYLPLNGHSALAT--EPSQ 301

  Fly   350 STSSPGSSPGTITPNGMDG 368
            :|:|......:.:.:|..|
  Rat   302 ATASGSYGGASYSHSGATG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 44/70 (63%)
Sox8NP_001100459.1 Sox_N 18..86 CDD:403592 19/68 (28%)
SOX-TCF_HMG-box 98..168 CDD:238684 43/69 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.