DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox14

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100320.1 Gene:Sox14 / 300954 RGDID:1309654 Length:240 Species:Rattus norvegicus


Alignment Length:254 Identity:108/254 - (42%)
Similarity:138/254 - (54%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            ||||||||||||||.|||::|::||||||||||||||||||||:|:||||:|||||||||.||||
  Rat     7 HIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKE 71

  Fly   206 HPDYKYRPRRKPKN---------PLTAGPQGG--LQMQAGGMGQQKLGAGPGAGAGGYNPFHQLP 259
            ||||||||||||||         ||   |..|  ..::|.|:   .:||..|..:........||
  Rat    72 HPDYKYRPRRKPKNLLKKDRYVFPL---PYLGDTDPLKAAGL---PVGASDGLLSAPEKARAFLP 130

  Fly   260 PYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAP-----PQLPPTSLS 319
            |..||...||   |..:                  :::|:    |:.|:.|     ..||..|..
  Rat   131 PASAPYSLLD---PAQF------------------SSSAI----QKMGEVPHTLATSALPYASTL 170

  Fly   320 SFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSALRRPV 378
            .:.:|.:..:|.||.: .|:      :||.      ::||.:.|........|.|:.||
  Rat   171 GYQNGAFGSLSCPSQH-THT------HPSP------TNPGYVVPCNCTAWSASTLQPPV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
Sox14NP_001100320.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)
SOXp 77..>118 CDD:403523 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.