DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox6

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_038962229.1 Gene:Sox6 / 293165 RGDID:1309000 Length:855 Species:Rattus norvegicus


Alignment Length:227 Identity:63/227 - (27%)
Similarity:93/227 - (40%) Gaps:74/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VNGSSGMGHH---MSSHMTP----------------HHMHQAVSAQQTLSPNSSIGSAGSLGSQ- 108
            :.||.|.|..   :||..:|                ..|.:.:..:|...|:...|...|:.|. 
  Rat   496 IGGSLGRGSSLDILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQPHGVDGKLSSMNSMG 560

  Fly   109 -------------SSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG-------------------- 140
                         .:||...:|.:|..|....|:..|......||                    
  Rat   561 LSNCRNEKERTRFENLGPQLTGKSSEDGKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTG 625

  Fly   141 ---------------------HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLA 184
                                 ||||||||||||::.:||:|.:..|.||||.|||.||:.||.::
  Rat   626 GATVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMS 690

  Fly   185 ESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            ..||:|:.:|..||..:|::::|:|||:||.|
  Rat   691 NQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 37/70 (53%)
Sox6XP_038962229.1 SOX-TCF_HMG-box 647..718 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.