DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox7

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001099515.1 Gene:Sox7 / 290317 RGDID:1310038 Length:383 Species:Rattus norvegicus


Alignment Length:311 Identity:93/311 - (29%)
Similarity:129/311 - (41%) Gaps:103/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRAL 201
            |.|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.|..|:|||::|||:|||..
  Rat    40 GSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQ 104

  Fly   202 HMKEHPDYKYRPRRK---------------------------PKNPLTAGPQGGLQMQAGGMGQQ 239
            ||:::|:||||||||                           .||.:..||.|    :....|:.
  Rat   105 HMQDYPNYKYRPRRKKQGKRLCKRVDPGFLLSSLSRDQNTLPEKNSIGRGPLG----EKEDRGEY 165

  Fly   240 KLGA-----------GPGAGAGG-------------YNPFHQLPP---YFAPSHHLDQGYP---- 273
            ..||           |..|..|.             .:|...|.|   :|:.|...:.|:|    
  Rat   166 APGATLPGLHSCYREGAAAAPGSVDTYPYGLPTPPEMSPLDALEPEQTFFSSSCQEEHGHPHHLP 230

  Fly   274 ----VPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQG----QAPPQLPPTSLSSFYSGIYSGIS 330
                .||...|.|   |.||.|....:.|:   ||..|    .:.|..||               
  Rat   231 HLPGPPYSPEFTP---SPLHCSHPLGSLAL---GQSPGVSMMSSVPGCPP--------------- 274

  Fly   331 APSLYAAHSANAAGLYPS-----SSTSSPGSSPGTITPNGMD-----GSMD 371
            :|:.|:  .|....|:|:     ...|.|...||..|.:.:.     |.||
  Rat   275 SPAYYS--HATYHPLHPNLQAHLGQLSPPPEHPGFDTLDQLSQVELLGDMD 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 39/70 (56%)
Sox7NP_001099515.1 SOX-TCF_HMG-box 44..115 CDD:238684 39/70 (56%)
Sox_C_TAD 178..381 CDD:288887 38/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.