DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox13

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:111/278 - (39%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGS--------LGSQSSLG 112
            ||..:...:..:| .|...|||..|      ....|:..||..:|..|.        ..::..|.
  Rat   297 PNTSSSPSLKMNS-CGPRPSSHGAP------TRDLQSSPPNLPLGFLGEGDAVTKAIQDARQLLH 354

  Fly   113 SNGSGL-NSSSGHQSAGMHSLATSPGQE-------------------------------GHIKRP 145
            |:...| ||.|......:.||.:||.:|                               .|||||
  Rat   355 SHSGALENSPSAPFRKDLISLDSSPAKERLEENCVHPLEEAMLGCDVDGSRHFSESRNSSHIKRP 419

  Fly   146 MNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYK 210
            |||||||::.:||:|.:..|.||||.|||.||:.||.:...||:|:.:|..||...|::::||||
  Rat   420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYK 484

  Fly   211 YRPRRKPKNP-------LTAGPQGGLQMQAGGMGQQKLGAGPGAG------------AGGYNPFH 256
            |:||  ||..       |..|....|........:|.....|.||            |.|.....
  Rat   485 YKPR--PKRTCVVEGRRLRVGEYKALMRTRRQGARQSYAIPPQAGQAQVSSDILFPRAAGMPLAR 547

  Fly   257 QLPPYFAPSHHLDQGYPV 274
            .|..::.| ..||...||
  Rat   548 PLVEHYDP-QGLDPNMPV 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 27/128 (21%)
SOX-TCF_HMG-box 415..486 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.