DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and mat1-Mc

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:mat1-Mc / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:23/72 - (31%)
Similarity:45/72 - (62%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPD 208
            ||.|||:::.:.:...:.|.||.::||::||.:|..|:..::..:..:...::..:|.|.|.:|.
pombe   105 RPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPG 169

  Fly   209 YKYRPRR 215
            |||:||:
pombe   170 YKYQPRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 23/72 (32%)
mat1-McNP_595867.1 HMG-box_ROX1-like 104..174 CDD:438791 21/68 (31%)

Return to query results.
Submit another query.