powered by:
Protein Alignment D and matmc_2
DIOPT Version :9
Sequence 1: | NP_001261830.1 |
Gene: | D / 39570 |
FlyBaseID: | FBgn0000411 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595867.1 |
Gene: | matmc_2 / 2539619 |
PomBaseID: | SPBC23G7.09 |
Length: | 181 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 45/72 - (62%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 RPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPD 208
||.|||:::.:.:...:.|.||.::||::||.:|..|:..::..:..:...::..:|.|.|.:|.
pombe 105 RPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPG 169
Fly 209 YKYRPRR 215
|||:||:
pombe 170 YKYQPRK 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0527 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000028 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10270 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R685 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.030 |
|
Return to query results.
Submit another query.