DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Meiosin

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001357740.1 Gene:Meiosin / 243866 MGIID:3647482 Length:589 Species:Mus musculus


Alignment Length:208 Identity:44/208 - (21%)
Similarity:70/208 - (33%) Gaps:85/208 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQ---TLSPN----SSIGSAG--------- 103
            |..||.|                  |.:...:||...   :||.|    |:.||:.         
Mouse   352 SSEGPTG------------------PPNFQSSVSLDHCYLSLSENVKVLSNCGSSSESTDTESLW 398

  Fly   104 ------------------SLGSQSSL-GSNGSGLNSSSGH----------QSAGM---------- 129
                              ||...|.| .:|..||.:||..          ||:|:          
Mouse   399 GQEEVRGVATYPRRTGVFSLAQPSVLQQANPEGLQTSSDEDRDYTWTPTGQSSGLPVASKKIKKV 463

  Fly   130 ----------HSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLA 184
                      .|....|||..  |:.:|.|:::.|:.|:|..:..|...::..:|.|...|:.:.
Mouse   464 QASQGPVKPKDSRKACPGQVK--KKCVNGFIMFCRMNRKQYIRACPGTASTAATKDLAQLWRGMT 526

  Fly   185 ESEKRPFIDEAKR 197
            ..||:|:..:|:|
Mouse   527 LEEKKPYCTKARR 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 15/58 (26%)
MeiosinNP_001357740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 14..27
bHLH_SF 24..73 CDD:469605
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 28..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363 5/28 (18%)
NHP6B 416..>539 CDD:227935 30/124 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..457 10/34 (29%)
HMG-box_BHMG1 484..549 CDD:438793 15/58 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..566
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.