DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sry

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035694.1 Gene:Sry / 21674 MGIID:98660 Length:395 Species:Mus musculus


Alignment Length:188 Identity:70/188 - (37%)
Similarity:92/188 - (48%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHM 203
            |||:||||||||||||.:|.::|:.||.|.|:||||:||..||.|.|:|||||..||:||:.||.
Mouse     2 EGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHR 66

  Fly   204 KEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKL------GAGPGA---------GAGGYN 253
            :::|:|||:|.|:.|    ...:.|:...|  :...||      ...|.|         .|..|:
Mouse    67 EKYPNYKYQPHRRAK----VSQRSGILQPA--VASTKLYNLLQWDRNPHAITYRQDWSRAAHLYS 125

  Fly   254 PFHQ---LPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQ 308
            ...|   ..|...|:.||.|                   |.|.......:|..|||.|
Mouse   126 KNQQSFYWQPVDIPTGHLQQ-------------------QQQQQQQQQFHNHHQQQQQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 43/70 (61%)
SryNP_035694.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 46/76 (61%)
SOX-TCF_HMG-box 4..74 CDD:238684 42/69 (61%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 13/15 (87%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 16/35 (46%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 2/5 (40%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 92..144 11/53 (21%)
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000269|PubMed:16166090 94..138 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..361 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.