DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox5

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006506994.1 Gene:Sox5 / 20678 MGIID:98367 Length:792 Species:Mus musculus


Alignment Length:236 Identity:77/236 - (32%)
Similarity:104/236 - (44%) Gaps:63/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAK 162
            |.||||...|:....|.|.|.|                   |.||||||||||||::.:||:|.:
Mouse   560 SDGSAGVSESRIYRESRGRGSN-------------------EPHIKRPMNAFMVWAKDERRKILQ 605

  Fly   163 DNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQG 227
            ..|.||||.|||.||:.||.:...||:|:.:|..||...|::::|||||:||  ||.....   .
Mouse   606 AFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPR--PKRTCLV---D 665

  Fly   228 GLQMQAG-----------------GMGQQKLGAGPGAGAGGYNP----FHQLPPYFAPSHHL--- 268
            |.:::.|                 .:|||  ...|.|.||...|    ...:|....||.|.   
Mouse   666 GKKLRIGEYKAIMRNRRQEMRQYFNVGQQ--AQIPIATAGVVYPSAIAMAGMPSPHLPSEHSSVS 728

  Fly   269 ---DQGYPV--PYFG--GFDPLALSKLHQSQAAAAAAVNNQ 302
               :.|.||  ..:|  |.:|      |..:...|..:|.:
Mouse   729 SSPEPGMPVIQSTYGAKGEEP------HIKEEIQAEDINGE 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox5XP_006506994.1 SOX-TCF_HMG-box 584..655 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.