DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox3

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033263.2 Gene:Sox3 / 20675 MGIID:98365 Length:450 Species:Mus musculus


Alignment Length:443 Identity:139/443 - (31%)
Similarity:187/443 - (42%) Gaps:123/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DYA--PQSQLQLSPGMDMDIKRVLHYSQS--------LAAMGGSPNGPAGQGVNGSSGMGHHMSS 76
            |:|  |.:.|...|  ::..:|.|..:.:        .|...|:|:.||             ..:
Mouse    19 DFARSPSASLPFPP--ELPARRPLSTTPTESPGLFTVAAPAPGAPSPPA-------------TLA 68

  Fly    77 HMTPHHMHQAVSAQQTLSP------------NSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGM 129
            |:.|.....::...:..:|            .::.|:||..|:..:.|:|..  |..||..:.|.
Mouse    69 HLLPAPAMYSLLETELKNPVGPPTPAAGTGVPAAPGAAGKSGANPAGGANAG--NGGSGGANGGG 131

  Fly   130 HSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDE 194
            .........:..:||||||||||||.|||::|.:|||||||||||||||:||||.::||||||||
Mouse   132 GGGGGGGSDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDE 196

  Fly   195 AKRLRALHMKEHPDYKYRPRRKPKNPLTAGP---QGGL----------QMQAGGMGQQKLGAGP- 245
            ||||||:||||:||||||||||.|..|....   .|||          ...|.......:|.|. 
Mouse   197 AKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPGGLLPPGAAAAAAAAAAAAAASSPVGVGQR 261

  Fly   246 --------GAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQ------------ 290
                    |...|.|:...:...|..|.   ....|.|      |.||.::|:            
Mouse   262 LDTYTHVNGWANGAYSLVQEQLGYAQPP---SMSSPPP------PPALPQMHRYDMAGLQYSPMM 317

  Fly   291 --------SQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYP 347
                    :.||||||.:..|   |.||      |.::..:..|....|.:..||.:|.|..|.|
Mouse   318 PPGAQSYMNAAAAAAAASGYG---GMAP------SAAAAAAAAYGQQPATAAAAAAAAAAMSLGP 373

  Fly   348 SSST--SSPGSSPGTIT-------------------PNGMDGSMDSALRRPVP 379
            ..|.  |.|.|.|..|.                   |.|.|.: |:|  .|:|
Mouse   374 MGSVVKSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAA-DAA--SPLP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 57/70 (81%)
Sox3NP_033263.2 SOX-TCF_HMG-box 143..214 CDD:238684 57/70 (81%)
SOXp 213..306 CDD:289133 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4213
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.