DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox18

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus


Alignment Length:312 Identity:97/312 - (31%)
Similarity:138/312 - (44%) Gaps:76/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSP------GQEG------------H 141
            |.|....|.:.|..::..:.|..:.:.|....|...||..||      |:.|            .
Mouse    14 PPSRRDCAWAPGIGAAAEARGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGERQTADELR 78

  Fly   142 IKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEH 206
            |:|||||||||::.:|:::|:.||.:||:.:||.||..||.|..:|||||::||:|||..|:::|
Mouse    79 IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDH 143

  Fly   207 PDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGP---GAGAGGYNPFHQLPPYFAPSHHL 268
            |:||||||||.:.......:.||.:.    |..:..|.|   .|.:|....|.:||...|....|
Mouse   144 PNYKYRPRRKKQARKVRRLEPGLLLP----GLVQPSAPPEAFAAASGSARSFRELPTLGAEFDGL 204

  Fly   269 DQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQA---PPQLPP--TSLSSFYSGIYSG 328
              |.|.|.....|                     |.:.|:|   ||.|.|  .:|.:|.:..   
Mouse   205 --GLPTPERSPLD---------------------GLEPGEASFFPPPLAPEDCALRAFRAPY--- 243

  Fly   329 ISAPSL-------YAAHSANA----------AGLYPSSSTSSPGSSPGTITP 363
              ||.|       |.|..|.|          |||| ..:..:||..|..::|
Mouse   244 --APELARDPSFCYGAPLAEALRTAPPAAPLAGLY-YGTLGTPGPFPNPLSP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 13/61 (21%)
SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 6/11 (55%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 19/91 (21%)
Sox_C_TAD 187..375 CDD:288887 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.