DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox17

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001276393.1 Gene:Sox17 / 20671 MGIID:107543 Length:419 Species:Mus musculus


Alignment Length:367 Identity:106/367 - (28%)
Similarity:156/367 - (42%) Gaps:99/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SSGMGHHMSSHMTPHHMHQAVSA-------QQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGH 124
            |...|:.......|.....||.|       .::|||...:...|.:     :.|:|:.. .:||.
Mouse     3 SPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEV-----VASSGAPA-GTSGR 61

  Fly   125 QSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKR 189
            ..|           |..|:|||||||||::.:|:::|:.||.:||:|:||.||..||.|..:|||
Mouse    62 AKA-----------ESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKR 115

  Fly   190 PFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGG-----LQMQAGGMGQQ-----KLGAG 244
            ||::||:|||..||::||:|||||||:.:.......:||     ::.|||.:|.:     ..|.|
Mouse   116 PFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLG 180

  Fly   245 -----PGAGAGGYNPFHQLPPYFAP---SHHLD-QGYPVPYFGGF-----DPLALSKLHQSQAAA 295
                 ||..||        ||..:|   .|:.| ||...|...|:     |...|..:.|..|..
Mouse   181 LPFPEPGYPAG--------PPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFF 237

  Fly   296 AA--------------------AVNNQ---------GQQQGQAPPQL--PPTSLSSFYSGIYSGI 329
            ||                    ||:.:         ....|.|.|.:  ||::|..:    |..:
Mouse   238 AAPLPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPAMPGILAPPSALHLY----YGAM 298

  Fly   330 SAPSLYAA---HSANAAGLYPSS-----STSSPGSSPGTITP 363
            .:|:..|.   |:.....|.|.:     ....|...||..:|
Mouse   299 GSPAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 40/70 (57%)
Sox17NP_001276393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 6/23 (26%)
SOX-TCF_HMG-box 67..138 CDD:238684 40/70 (57%)
Sox17_18_mid 203..253 CDD:403331 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..356 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.