DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox15

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:246 Identity:99/246 - (40%)
Similarity:127/246 - (51%) Gaps:52/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LNSSSGHQSAGMHSLAT---------------SPGQEG-----HIKRPMNAFMVWSRLQRRQIAK 162
            |.|||..::..:|..|:               |||..|     .:|||||||||||.:||||:|:
Mouse     3 LTSSSQAETWSLHPRASTASLPLGPQEQEAGGSPGASGGLPLEKVKRPMNAFMVWSSVQRRQMAQ 67

  Fly   163 DNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQG 227
            .|||||||||||||||:||||.:.|||||::|||||||.|::::||||||||||.||..|.... 
Mouse    68 QNPKMHNSEISKRLGAQWKLLGDEEKRPFVEEAKRLRARHLRDYPDYKYRPRRKSKNSSTGSVP- 131

  Fly   228 GLQMQAGGM--GQQKLGAG----PGAGAGGYNPFH----QLPPYFAPSHHLDQGYPVP-YFGGFD 281
             ...:.||:  |....|.|    .|:...||.|.:    .||..:..||...:. |:| .|...|
Mouse   132 -FSQEGGGLACGGSHWGPGYTTTQGSRGFGYQPPNYSTAYLPGSYTSSHCRPEA-PLPCTFPQSD 194

  Fly   282 PLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAP 332
            |                 ..||:.:....|.|.|.| |:.|:...:|...|
Mouse   195 P-----------------RLQGELRPSFSPYLSPDS-STPYNTSLAGAPMP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 52/70 (74%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 10/41 (24%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 10/41 (24%)
SOX-TCF_HMG-box 46..117 CDD:238684 52/70 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 13/26 (50%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.