DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox13

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_011246247.1 Gene:Sox13 / 20668 MGIID:98361 Length:621 Species:Mus musculus


Alignment Length:341 Identity:99/341 - (29%)
Similarity:130/341 - (38%) Gaps:103/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQSQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSA 89
            |.|||.| |...:..|.|.:..|.|    .||..|    |...||:..|......|..::.....
Mouse   244 PDSQLAL-PIQPIPCKPVEYPLQLL----HSPPAP----VVKRSGVAAHHPLQEPPQPLNLTAKP 299

  Fly    90 QQTLSPNSS------IGSAG----SLGS-----QSS-----LGSNGSG-------------LNSS 121
            :....||:|      :.|.|    |.|:     |||     ||..|.|             |:|.
Mouse   300 KVPELPNTSSSPSLKMNSCGPRPASHGAPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSH 364

  Fly   122 SGHQS--------AGMHSLATSPGQE-------------------------------GHIKRPMN 147
            ||...        ..:.||.:||.:|                               .|||||||
Mouse   365 SGALENSPNTPFRKDLISLDSSPAKERLEESCVHPLEEAMLSCDMDGSRHFSESRNSSHIKRPMN 429

  Fly   148 AFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYR 212
            |||||::.:||:|.:..|.||||.|||.||:.||.:...||:|:.:|..||...|::::|||||:
Mouse   430 AFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYK 494

  Fly   213 PRRKPKNP-------LTAGPQGGLQMQAGGMGQQKLGAGPGAG------------AGGYNPFHQL 258
            ||  ||..       |..|....|........:|.....|.||            |.|......|
Mouse   495 PR--PKRTCVVEGRRLRVGEYKALMRTRRQGARQSYTIPPQAGQAQVSSDILFPRAAGLPLARPL 557

  Fly   259 PPYFAPSHHLDQGYPV 274
            ..::.| ..||...||
Mouse   558 VEHYDP-QGLDPNMPV 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox13XP_011246247.1 Atrophin-1 <231..>340 CDD:367360 28/104 (27%)
SOX-TCF_HMG-box 423..494 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.