DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox-3

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_510439.1 Gene:sox-3 / 185534 WormBaseID:WBGene00004950 Length:212 Species:Caenorhabditis elegans


Alignment Length:245 Identity:100/245 - (40%)
Similarity:119/245 - (48%) Gaps:73/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QQTLSPNSSIGSAGS-LGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWS 153
            :.|.|.:|.:...|| :..|:||                            .|:|||||||||||
 Worm    23 EDTTSVSSGLSPPGSPVDLQNSL----------------------------DHVKRPMNAFMVWS 59

  Fly   154 RLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK 218
            |.|||::|:|||||||||||||||||||.|:|.||||||||||||||||||||||||||||||||
 Worm    60 RGQRRKMAQDNPKMHNSEISKRLGAEWKQLSEQEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK 124

  Fly   219 NP-LTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPY----------FAPSHHLDQGY 272
            :. |...|:..:.|..                        :||.          ...:|.|.|.|
 Worm   125 SSNLKQQPRLNIAMPT------------------------IPPQSLFNYSTAFDSLKTHDLSQYY 165

  Fly   273 ------PVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPT 316
                  ||.....:.|..:...:..||||.||.:   |......|..|.|
 Worm   166 SSFFQSPVLSGSTYAPYNMMAAYARQAAAVAAAS---QVSASTTPTAPAT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 62/70 (89%)
sox-3NP_510439.1 SOX-TCF_HMG-box 47..118 CDD:238684 62/70 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.