DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and egl-13

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:237 Identity:80/237 - (33%)
Similarity:112/237 - (47%) Gaps:51/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QSQLQLSPGMDMDIKRVLHYSQSL--------------------AAMGGSPNGPAGQGVN----- 65
            |.:|.......|.|..:|..:|||                    |.:.|....|....::     
 Worm   172 QHELMQHQQQQMIIANMLKATQSLPLLFNGGLNYEAILNNPVLNATIAGHLPNPLASNISLLQKS 236

  Fly    66 -----GSSGMGHHMSSHMTPHHMHQAVSAQQTL--SPNSSIGSAGSLGSQSSLGSNGSGLN---- 119
                 .::|....:....||.::.:...:...:  ||.|......|||  ::.||:|...|    
 Worm   237 ISAKLAAAGNMQTVEKVETPLNLSKDTPSPTAIPQSPLSGFRLPYSLG--TNYGSDGQLFNNCSP 299

  Fly   120 SSSGHQSAGMHSL----------ATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISK 174
            :|||..:.|..|:          |.||   .||||||||||||:|.:||:|.|..|.||||.|||
 Worm   300 NSSGKSTPGNTSVTSEVATPRPQAKSP---NHIKRPMNAFMVWARDERRKILKAYPDMHNSNISK 361

  Fly   175 RLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            .||:.||.::.|||:|:.:|..||..|||::||||:||||.|
 Worm   362 ILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 43/70 (61%)
egl-13NP_001024918.1 SOX-TCF_HMG-box 328..399 CDD:238684 43/70 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.