DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and hmg-4

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_498633.1 Gene:hmg-4 / 176052 WormBaseID:WBGene00001974 Length:697 Species:Caenorhabditis elegans


Alignment Length:230 Identity:44/230 - (19%)
Similarity:81/230 - (35%) Gaps:54/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EDYAPQSQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNGPAGQG-VNGSSGMGHHM--SSHMTPHH 82
            |||          .:|.|||:.....:|....|..|:.....| ...|||.|...  |....|..
 Worm   469 EDY----------DLDKDIKKKKEDKESSEGTGSEPDDEYDSGSEQDSSGTGESEPDSEQDVPSK 523

  Fly    83 MHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMN 147
            ..:....::...........|..|.:..                        .|...   ||..:
 Worm   524 RRKGEPKEKREKKEKREKKEGKKGKKDK------------------------DPNAP---KRATS 561

  Fly   148 AFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYR 212
            |:|.|....|.::.:|...:  ::::|:.||:||.::..:|:.:.::|:..::.:.||..:|:  
 Worm   562 AYMQWFLASRNELKEDGDSV--ADVAKKGGAKWKTMSSDDKKKWEEKAEEDKSRYEKEMKEYR-- 622

  Fly   213 PRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGA 247
                 ||    ||.......:.....:| .:||.:
 Worm   623 -----KN----GPPSSSSKPSSSKTSKK-SSGPSS 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 17/70 (24%)
hmg-4NP_498633.1 SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051
HMGB-UBF_HMG-box 556..619 CDD:238686 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.