DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sem-2

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_740846.1 Gene:sem-2 / 172162 WormBaseID:WBGene00004771 Length:404 Species:Caenorhabditis elegans


Alignment Length:390 Identity:114/390 - (29%)
Similarity:152/390 - (38%) Gaps:129/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 MSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPG- 137
            |.....|:.|.....|...:.|.:...:|.::.|.:|..:|.:..||.:..|....|...|:.| 
 Worm     1 MDLQKPPNFMLDCGMAPHMMPPINWAAAAIAVASSTSGATNATSSNSVATSQQLQHHPYGTAAGG 65

  Fly   138 -----------------------QEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAE 179
                                   ...|||||||||||||:::||:|.:..|.|||:||||:||:.
 Worm    66 YKHAQQAIPKSVTPYSDATNCKKSSNHIKRPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSR 130

  Fly   180 WKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQK---- 240
            |:.|.:.||.||:.||:|||..||:|:|||||:||:|||.    .|.|.||..|.....|:    
 Worm   131 WRSLTDEEKAPFVAEAERLRVCHMQEYPDYKYKPRKKPKK----NPDGTLQQPAQPQAPQQQQAP 191

  Fly   241 -LGAGPGA----------------------------GAGGYNPFHQLPPYFAPSHHLDQGYPVPY 276
             .||.|.|                            ..|..:..|.....|.||      ||.|.
 Worm   192 PRGASPQARQRKRPNTDQQSETQQFQNFKSVKVEQDWMGNAHMSHAQKMPFHPS------YPSPS 250

  Fly   277 FGGFDPLA------------------LSKLHQSQAAAAAAVNNQGQQQGQAPPQL---------- 313
            ..|..||.                  .:..|.:.|.:...:.|.|...|. |||:          
 Worm   251 EFGHAPLTPESGFYDDYFTQQHHQQHFASQHHNSAGSPLRMTNLGMDMGM-PPQMMGHNSGFGAG 314

  Fly   314 ---------PPT-------SLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTIT 362
                     ||:       ||||..||          ||..||:      ..|||||.|: |.:|
 Worm   315 NHPFYLHTSPPSVDQDDMRSLSSGSSG----------YADCSAS------EQSTSSPNSA-GVVT 362

  Fly   363  362
             Worm   363  362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 44/70 (63%)
sem-2NP_740846.1 SOX-TCF_HMG-box 92..159 CDD:238684 40/66 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.