DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox10

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571950.1 Gene:sox10 / 140616 ZFINID:ZDB-GENE-011207-1 Length:485 Species:Danio rerio


Alignment Length:510 Identity:124/510 - (24%)
Similarity:185/510 - (36%) Gaps:192/510 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNG-----PA-----------GQGVNGSSGMGHHMS 75
            |::::|||:..|     .:|.|.....|:|.|     |.           |.||:|...:.....
Zfish     9 SEVEMSPGVSDD-----GHSMSPGHSSGAPGGADSPLPGQQSQMSGIGDDGAGVSGGVSVKSDEE 68

  Fly    76 SHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG 140
            ....|..:.:|||  |.|:           |...:|......:||.|          .:.|    
Zfish    69 DDRFPIGIREAVS--QVLN-----------GYDWTLVPMPVRVNSGS----------KSKP---- 106

  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||::..||::|...|.:||:|:||.||..|:||.|::|||||:||:|||..|.|:
Zfish   107 HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNETDKRPFIEEAERLRKQHKKD 171

  Fly   206 HPDYKYRPRRK------------------------------------------------------ 216
            :|:|||:|||:                                                      
Zfish   172 YPEYKYQPRRRKNGKPGSSSEADAHSEGEVSHSQSHYKSLHLEVAHGGAAGSPLGDGHHPHATGQ 236

  Fly   217 ---PKNPLTAGPQGGLQMQAGGMGQQKLGA---GPGAGAGG------------------------ 251
               |..|.|. |:..||....|.|:::.||   |.|.||.|                        
Zfish   237 SHSPPTPPTT-PKTELQGGKSGEGKREGGASRSGLGVGADGSSASSSASGKPHIDFGNVDIGEIS 300

  Fly   252 ------YNPF--HQLPPYFAPSHH------LDQGYPVP--YFGGFDPLALSKLHQSQAAAAAAVN 300
                  ..||  ::...|..|:.|      ...|...|  .:|....||.:..|.:...:...:.
Zfish   301 HDVMANMEPFDVNEFDQYLPPNGHPQASATASAGSAAPSYTYGISSALAAASGHSTAWLSKQQLP 365

  Fly   301 NQ-------GQQQGQAPPQLP-------------PTSLSSFYSGI-----------YSGISAPSL 334
            :|       |:.|.::....|             |.:|..:.|..           |:...|...
Zfish   366 SQQHLGADGGKTQIKSETHFPGDTAASGSHVTYTPLTLPHYSSAFPSLASRAQFAEYAEHQASGS 430

  Fly   335 YAAHSANAAGLY-------PS-----SSTSSPGSSPGTITPNGMDGSMDSALRRP 377
            |.|||:..:|||       ||     ::...|||.|.:.:|...:..:.:.|.||
Zfish   431 YYAHSSQTSGLYSAFSYMGPSQRPLYTAIPDPGSVPQSHSPTHWEQPVYTTLSRP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 41/70 (59%)
sox10NP_571950.1 Sox_N 13..97 CDD:289229 22/101 (22%)
SOX-TCF_HMG-box 107..177 CDD:238684 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.