DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sox5

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006237666.1 Gene:Sox5 / 140587 RGDID:620471 Length:764 Species:Rattus norvegicus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:109/260 - (41%) Gaps:87/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAK 162
            |.||||...|:....|.|.|.|                   |.||||||||||||::.:||:|.:
  Rat   532 SDGSAGVSESRIYRESRGRGSN-------------------EPHIKRPMNAFMVWAKDERRKILQ 577

  Fly   163 DNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQG 227
            ..|.||||.|||.||:.||.:...||:|:.:|..||...|::::|||||:||  ||.....   .
  Rat   578 AFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPR--PKRTCLV---D 637

  Fly   228 GLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQ 292
            |.:::   :|:.|        |...|...::..||                              
  Rat   638 GKKLR---IGEYK--------AIMRNRRQEMRQYF------------------------------ 661

  Fly   293 AAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSG--IYSGISAPSLYAAHSANAAGLYPSSSTSSPG 355
                    |.|||     .|:|..:....|.|  ..:|:.:|.|.:.||:       .||:..||
  Rat   662 --------NVGQQ-----AQIPIATAGVVYPGAIAMAGMPSPHLPSEHSS-------VSSSPEPG 706

  Fly   356  355
              Rat   707  706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
Sox5XP_006237666.1 SOX-TCF_HMG-box 556..627 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.