DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox32

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:238 Identity:68/238 - (28%)
Similarity:115/238 - (48%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HHM-HQAVSAQQTL-SPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIK 143
            |:: ||....::|. .|.|...|..|:||:||..|                 ..|.:| .|..::
Zfish    25 HYLQHQNDEQRRTAHCPASGPLSPVSVGSESSCSS-----------------PEAKAP-VETRVR 71

  Fly   144 RPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPD 208
            ||:|||::|::.:||::|:.||.:.|:::||.||..||.::.::|||::.||:|||..|..::|:
Zfish    72 RPLNAFIIWTKEERRRLAQLNPDLENTDLSKILGKTWKAMSLADKRPYMQEAERLRIQHTIDYPN 136

  Fly   209 YKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGA---------GAGGYNPFHQLPPYFAP 264
            |||||||:..|           .::..|...:..:.|.|         |.....|::|:..|..|
Zfish   137 YKYRPRRRKCN-----------KRSSKMPSSENVSSPNATFDLSYMFQGQAPQRPYNQINSYRLP 190

  Fly   265 -----------SHHLD--QGYPVPYFGGFDPLALSKLHQSQAA 294
                       |:|.:  ......:.||...:.||.:|..::|
Zfish   191 HNGFSFENHSSSYHFEATSSSGNVFHGGATSMNLSNVHLPRSA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 30/70 (43%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.