DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and LOC103910042

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_009296780.2 Gene:LOC103910042 / 103910042 -ID:- Length:221 Species:Danio rerio


Alignment Length:251 Identity:100/251 - (39%)
Similarity:121/251 - (48%) Gaps:67/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            ||||||||||||||.||||:|.:||||||||||||||||||.|::|||||:|||||||||.||:|
Zfish    13 HIKRPMNAFMVWSRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQHMRE 77

  Fly   206 HPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQ 270
            |||||||||||||..|                                             ..|.
Zfish    78 HPDYKYRPRRKPKGLL---------------------------------------------RKDM 97

  Fly   271 GYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLY 335
            ...:|..|..|......:|.|.|||    .:|..:|.::...:.|.....|.:|  |...:|:|.
Zfish    98 VLSLPLVGQSDSEKPRDVHSSSAAA----QHQFVEQSRSTCTVFPHEKLGFSTG--SLAFSPALG 156

  Fly   336 AAHSANAAGLYPSSSTSSPG---------SSPGTITPNGMDGSMDSALRRPVPVLY 382
            ......:||     |...||         ::||.:.|  ...|..||...|.|:.|
Zfish   157 YQGGHRSAG-----SLGCPGQFAHTHLSPANPGYLLP--CSCSHWSASLSPPPLAY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 60/70 (86%)
LOC103910042XP_009296780.2 SOX-TCF_HMG-box 13..84 CDD:238684 60/70 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.