DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and Sry4

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001403684.1 Gene:Sry4 / 103694534 RGDID:9176662 Length:162 Species:Rattus norvegicus


Alignment Length:80 Identity:51/80 - (63%)
Similarity:67/80 - (83%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHM 203
            |||:||||||||||||.:||::|:.||.|.||||||:||.:||.|.|:|||||..||:||:.||.
  Rat     2 EGHVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHR 66

  Fly   204 KEHPDYKYRPRRKPK 218
            :::|:|||:|.|:.|
  Rat    67 EKYPNYKYQPHRRVK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 50/79 (63%)
Sry4NP_001403684.1 HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 47/74 (64%)

Return to query results.
Submit another query.