DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox8a

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001271361.1 Gene:sox8a / 102216265 ZFINID:ZDB-GENE-130530-719 Length:401 Species:Danio rerio


Alignment Length:349 Identity:103/349 - (29%)
Similarity:139/349 - (39%) Gaps:122/349 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFI 192
            |..||...|    |:||||||||||::..||::|...|.:||:|:||.||..|:||:|||||||:
Zfish    76 GSRSLKDKP----HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFV 136

  Fly   193 DEAKRLRALHMKEHPDYKYRPRR----KP-KNPLTAGPQGGL-------QMQAG--GMGQQKLGA 243
            :||:|||..|.|::|||||:|||    || :|...||.:..|       :.:||  .|..|.:  
Zfish   137 EEAERLRLQHKKDYPDYKYQPRRRKSLKPGQNEAEAGAEKNLHHTDPIYKTEAGMRAMHHQTI-- 199

  Fly   244 GPGAGAGGYNPFHQLPPYFAPSHHLDQG--------------------------------YPVPY 276
                  .|..|.....|...|.....|.                                :.|..
Zfish   200 ------HGVQPHGPPTPPTTPKSDQHQSMKRLSENARQNIDFSNVDISELSSDVIGSISQFDVRE 258

  Fly   277 FGGFDPL-----------------ALSKLHQSQAAA---------AAAVNNQ------------- 302
            |..:.||                 :.|..|.|.|:|         .::.|.|             
Zfish   259 FDQYLPLNGHTESGGGQHSSPGCFSTSFHHHSGASAWNKPSGSPSTSSANQQRPLIKTEQLSPSH 323

  Fly   303 -GQQQGQ---------APPQLPP--TSLSSFYSGIYSGISAPSLYA-AHSANAAGLYPSSST-SS 353
             ||..|.         |..|..|  |:.|.:.:|||.       |. .||...:.:.|..:| ||
Zfish   324 YGQSHGSPTQSELSDCADMQNSPYFTTFSGYPAGIYQ-------YPYFHSTRRSYMTPVLNTLSS 381

  Fly   354 PGSSPGTITPNGMDGSMDSALRRP 377
            |..||||    ..:..:.:.|.||
Zfish   382 PSHSPGT----NWEQPVYTTLTRP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 43/70 (61%)
sox8aNP_001271361.1 Sox_N <40..73 CDD:372113
SOX-TCF_HMG-box 85..155 CDD:238684 42/69 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.