DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox8

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002932315.2 Gene:sox8 / 100497725 XenbaseID:XB-GENE-480865 Length:466 Species:Xenopus tropicalis


Alignment Length:382 Identity:110/382 - (28%)
Similarity:153/382 - (40%) Gaps:111/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPG 137
            :|||.. .|......|...|.|..|.:..:.|....|..||.|.|     .|:..|:..|:...|
 Frog     3 NMSSEQ-EHVPEPPCSPTGTASSMSHVSDSDSDSPLSPAGSEGRG-----SHRPPGISQLSKRDG 61

  Fly   138 QE---------------------------------------GHIKRPMNAFMVWSRLQRRQIAKD 163
            :|                                       .|:||||||||||::..||::|..
 Frog    62 EETMDERFPACIREAVSQVLKGYDWSLVPMPVRGSGGLKAKPHVKRPMNAFMVWAQAARRKLADQ 126

  Fly   164 NPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAG---P 225
            .|.:||:|:||.||..|:||:|:|||||::||:|||..|.|:||||||:|||  :....||   .
 Frog   127 YPHLHNAELSKTLGKLWRLLSENEKRPFVEEAERLRVQHKKDHPDYKYQPRR--RKSAKAGQSDS 189

  Fly   226 QGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQ--GYPVP--------YFGGF 280
            ..|.::...| |.|...:..|.|:.|.|..|        |.|..|  |.|.|        :.||.
 Frog   190 DSGAELGLHG-GSQMYKSDSGMGSMGENHLH--------SEHAGQNHGPPTPPTTPKTDLHHGGK 245

  Fly   281 DPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLY---------- 335
            ..|.    |:.:         :..:.|:.........:|...|.:.:.|.|..::          
 Frog   246 QELK----HEGR---------RMMESGRQNIDFSNVDISELSSEVINNIEAFDVHEFDQYLPLNG 297

  Fly   336 -----AAHSANA-AGLYPSSSTSSPGS---------SPGTITPNGMDGSMDSALRRP 377
                 |.|..|| |..|.||.|.:||:         ||.|    ....|.:|..:||
 Frog   298 HGPIPADHGQNATAAPYASSYTHAPGATAAPVWSHKSPST----SSSSSSESGQQRP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 43/70 (61%)
sox8XP_002932315.2 Sox_N <39..94 CDD:372113 9/59 (15%)
SOX-TCF_HMG-box 104..174 CDD:238684 42/69 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.